Showing 1 - 3 results out of 3 with the query:
AB_1079748
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RBM25 antibody produced in rabbit
Human RBM25 human
(Sigma-Aldrich Cat# HPA003025, RRID:AB_1079748)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA003025
Anti-RBM25 antibody produced in rabbit
RBM25 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003025, RRID:AB_1079748)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA003025
Anti-RBM25 polyclonal antibody Go To Vendor
RBM25 epitope: PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV See NCBI gene human
(Atlas Antibodies Cat# HPA003025, RRID:AB_1079748)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA003025