Showing 1 - 3 results out of 3 with the query:
AB_1079749
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-RBM39 antibody produced in rabbit
Human RBM39 human
(Sigma-Aldrich Cat# HPA001591, RRID:AB_1079749)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA001591
Anti-RBM39 antibody produced in rabbit
RBM39 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001591, RRID:AB_1079749)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA001591
Anti-RBM39 polyclonal antibody
RBM39 epitope: LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ See NCBI gene human
(Atlas Antibodies Cat# HPA001591, RRID:AB_1079749)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA001591