Showing 1 - 3 results out of 3 with the query:
AB_1079857
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-S100A1 antibody produced in rabbit
Human S100A1 human
(Sigma-Aldrich Cat# HPA006462, RRID:AB_1079857)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006462
Anti-S100A1 antibody Go To Vendor
S100A1 epitope: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS See NCBI gene human
(Atlas Antibodies Cat# HPA006462, RRID:AB_1079857)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006462
Anti-S100A1 antibody produced in rabbit
S100A1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006462, RRID:AB_1079857)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA006462