Showing 1 - 3 results out of 3 with the query:
AB_1080076
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-SPTB antibody produced in rabbit
Human SPTB human
(Sigma-Aldrich Cat# HPA003394, RRID:AB_1080076)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA003394
Anti-SPTB polyclonal antibody
SPTB epitope: TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEF See NCBI gene human
(Atlas Antibodies Cat# HPA003394, RRID:AB_1080076)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA003394
Anti-SPTB antibody produced in rabbit
SPTB antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003394, RRID:AB_1080076)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA003394