Showing 1 - 3 results out of 3 with the query:
AB_1080104
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
STAT4-human antibody
STAT4 homo sapiens
(Sigma-Aldrich Cat# HPA001860, RRID:AB_1080104)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R00593 for not specified; status is not pursued
rabbit
Sigma-Aldrich Go To Vendor
HPA001860
Anti-STAT4 antibody produced in rabbit
STAT4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001860, RRID:AB_1080104)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA001860
Anti-STAT4 antibody
STAT4 epitope: PMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDL See NCBI gene human
(Atlas Antibodies Cat# HPA001860, RRID:AB_1080104)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA001860