Showing 1 - 3 results out of 3 with the query:
AB_1080165
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-STX3 antibody produced in rabbit
Human STX3 human
(Sigma-Aldrich Cat# HPA002191, RRID:AB_1080165)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002191
Anti-STX3 antibody produced in rabbit
STX3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002191, RRID:AB_1080165)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA002191
Anti-STX3 polyclonal antibody
STX3 epitope: KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK See NCBI gene human
(Atlas Antibodies Cat# HPA002191, RRID:AB_1080165)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA002191