Showing 1 - 3 results out of 3 with the query:
AB_1080352
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TRAF3 antibody produced in rabbit
Human TRAF3 human
(Sigma-Aldrich Cat# HPA002933, RRID:AB_1080352)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA002933
Anti-TRAF3 antibody produced in rabbit
TRAF3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002933, RRID:AB_1080352)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA002933
Anti-TRAF3 polyclonal antibody
TRAF3 epitope: SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV See NCBI gene human
(Atlas Antibodies Cat# HPA002933, RRID:AB_1080352)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA002933