Showing 1 - 3 results out of 3 with the query:
AB_1080378
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
TRIM22-human antibody
TRIM22 homo sapiens
(Sigma-Aldrich Cat# HPA003575, RRID:AB_1080378)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot A11983 for GM12878,HeLa-S3,MCF-7,HepG2,liver,K562; status is awaiting lab characterization,not eligible for new data
rabbit
Sigma-Aldrich Go To Vendor
HPA003575
Anti-TRIM22 polyclonal antibody
TRIM22 epitope: NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV See NCBI gene human
(Atlas Antibodies Cat# HPA003575, RRID:AB_1080378)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA003575
Anti-TRIM22 antibody produced in rabbit
TRIM22 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003575, RRID:AB_1080378)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA003575