Showing 1 - 3 results out of 3 with the query:
AB_1080679
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ZNF174-human antibody Go To Vendor
ZNF174 homo sapiens
(Sigma-Aldrich Cat# HPA009656, RRID:AB_1080679)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R01979 for any cell type or tissues; status is awaiting lab characterization
rabbit
Sigma-Aldrich
HPA009656
Anti-ZNF174 antibody Go To Vendor
ZNF174 epitope: VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQ See NCBI gene human
(Atlas Antibodies Cat# HPA009656, RRID:AB_1080679)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA009656
Anti-ZNF174 antibody produced in rabbit
ZNF174 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA009656, RRID:AB_1080679)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA009656