Showing 1 - 3 results out of 3 with the query:
AB_1080700
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
ZNF275-human antibody
ZNF275 homo sapiens
(Sigma-Aldrich Cat# HPA000566, RRID:AB_1080700)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R00185 for not specified; status is not pursued
rabbit
Sigma-Aldrich Go To Vendor
HPA000566
Anti-ZNF275 antibody produced in rabbit
ZNF275 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000566, RRID:AB_1080700)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA000566
Anti-ZNF275 polyclonal antibody
ZNF275 epitope: WECGDCGKVFRGVAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACKACSRDF See NCBI gene human
(Atlas Antibodies Cat# HPA000566, RRID:AB_1080700)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA000566