Showing 1 - 5 results out of 5 with the query:
AB_1080707
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ZKSCAN1 antibody produced in rabbit
Human ZKSCAN1 human
(Sigma-Aldrich Cat# HPA006672, RRID:AB_1080707)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006672
Anti-ZKSCAN1 antibody produced in rabbit
ZKSCAN1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006672, RRID:AB_1080707)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA006672
ENCODE Project Antibody validation ZKSCAN1_(HPA006672)
ZKSCAN1 human
(Sigma-Aldrich Cat# HPA006672, RRID:AB_1080707)
polyclonal antibody
Rabbit polyclonal affinity purified, Immunogen: Zinc finger with KRAB and SCAN domain-containing protein 1 recombinant protein epitope signature tag (PrEST). Antibody Target: ZKSCAN1
Validation: ENCODE PROJECT validation information available
rabbit
Sigma-Aldrich
HPA006672
Anti-ZKSCAN1 polyclonal antibody Go To Vendor
ZKSCAN1 epitope: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR See NCBI gene human
(Atlas Antibodies Cat# HPA006672, RRID:AB_1080707)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006672
ZKSCAN1-human antibody Go To Vendor
ZKSCAN1 homo sapiens
(Sigma-Aldrich Cat# HPA006672, RRID:AB_1080707)
polyclonal antibody
ENCODE PROJECT External validation DATA SET is released testing lot A44630 for HepG2,K562,GM12878,HeLa-S3,MCF-7,HEK293T; status is eligible for new data,awaiting lab characterization,pending dcc review
rabbit
Sigma-Aldrich
HPA006672