Showing 1 - 3 results out of 3 with the query:
AB_1080718
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
MZF1-human antibody
MZF1 homo sapiens
(Sigma-Aldrich Cat# HPA001757, RRID:AB_1080718)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot A01100 for any cell type or tissues; status is awaiting lab characterization
rabbit
Sigma-Aldrich Go To Vendor
HPA001757
Anti-MZF1 antibody produced in rabbit
MZF1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001757, RRID:AB_1080718)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA001757
Anti-MZF1 polyclonal antibody
MZF1 epitope: TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK See NCBI gene human
(Atlas Antibodies Cat# HPA001757, RRID:AB_1080718)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA001757