Showing 1 - 3 results out of 3 with the query:
AB_10959603
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-THOC3 antibody produced in rabbit
THOC3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA044009, RRID:AB_10959603)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA044009
Anti-THOC3 antibody produced in rabbit
THOC3 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA044009, RRID:AB_10959603)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA044009
Anti-THOC3 polyclonal antibody Go To Vendor
THOC3 epitope: HDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA044009, RRID:AB_10959603)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA044009