Showing 1 - 3 results out of 3 with the query:
AB_10961275
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-DNPEP antibody produced in rabbit
DNPEP antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA044860, RRID:AB_10961275)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA044860
Anti-DNPEP antibody Go To Vendor
DNPEP epitope: FDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLNAVDER See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA044860, RRID:AB_10961275)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA044860
Anti-DNPEP antibody produced in rabbit
DNPEP antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA044860, RRID:AB_10961275)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Sigma-Aldrich
HPA044860