Showing 1 - 3 results out of 3 with the query:
AB_10962485
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PTCD2 antibody produced in rabbit
PTCD2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA043686, RRID:AB_10962485)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA043686
Anti-PTCD2 polyclonal antibody Go To Vendor
PTCD2 epitope: KLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLK See NCBI gene human
(Atlas Antibodies Cat# HPA043686, RRID:AB_10962485)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA043686
Anti-PTCD2 antibody produced in rabbit
PTCD2 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA043686, RRID:AB_10962485)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Sigma-Aldrich
HPA043686