Showing 1 - 3 results out of 3 with the query:
AB_10964632
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-VMO1 antibody produced in rabbit
VMO1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023038, RRID:AB_10964632)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Sigma-Aldrich
HPA023038
Anti-VMO1 antibody produced in rabbit
VMO1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA023038, RRID:AB_10964632)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA023038
Anti-VMO1 polyclonal antibody
VMO1 epitope: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL See NCBI gene human
(Atlas Antibodies Cat# HPA023038, RRID:AB_10964632)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA023038