Showing 1 - 3 results out of 3 with the query:
AB_10967059
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-STK38L antibody produced in rabbit
STK38L antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA038623, RRID:AB_10967059)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA038623
Anti-STK38L polyclonal antibody Go To Vendor
STK38L epitope: STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL See NCBI gene human
(Atlas Antibodies Cat# HPA038623, RRID:AB_10967059)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038623
Anti-STK38L antibody produced in rabbit
STK38L antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038623, RRID:AB_10967059)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Sigma-Aldrich
HPA038623