Showing 1 - 2 results out of 2 with the query:
AB_1669899
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SLC10A6 Antibody
SLC10A6 human
(Sigma-Aldrich Cat# HPA016662, RRID:AB_1669899)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Consolidation on 8/2020: AB_1669899, AB_1856961.
rabbit
Sigma-Aldrich
HPA016662
Anti-SLC10A6 polyclonal antibody
SLC10A6 epitope: KRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE See NCBI gene human
(Atlas Antibodies Cat# HPA016662, RRID:AB_1669899)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA016662