Showing 1 - 3 results out of 3 with the query:
AB_1844432
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ABCC1 antibody produced in rabbit
Human ABCC1 human
(Sigma-Aldrich Cat# HPA002380, RRID:AB_1844432)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA002380
Anti-ABCC1 antibody produced in rabbit
ABCC1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002380, RRID:AB_1844432)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA002380
Anti-ABCC1 polyclonal antibody Go To Vendor
ABCC1 epitope: LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD See NCBI gene human
(Atlas Antibodies Cat# HPA002380, RRID:AB_1844432)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA002380