Showing 1 - 3 results out of 3 with the query:
AB_1844454
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ABL1 antibody produced in rabbit
Human ABL1 human
(Sigma-Aldrich Cat# HPA027280, RRID:AB_1844454)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA027280
Anti-ABL1 antibody produced in rabbit
ABL1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA027280, RRID:AB_1844454)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA027280
Anti-ABL1 polyclonal antibody
ABL1 epitope: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP See NCBI gene human
(Atlas Antibodies Cat# HPA027280, RRID:AB_1844454)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA027280