Showing 1 - 3 results out of 3 with the query:
AB_1844513
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ACLY antibody produced in rabbit
Human ACLY human
(Sigma-Aldrich Cat# HPA022434, RRID:AB_1844513)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA022434
Anti-ACLY antibody Go To Vendor
ACLY epitope: AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA022434, RRID:AB_1844513)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022434
Anti-ACLY antibody produced in rabbit
ACLY antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022434, RRID:AB_1844513)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA022434