Showing 1 - 3 results out of 3 with the query:
AB_1844633
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-AFF4 antibody produced in rabbit
Human AFF4 human
(Sigma-Aldrich Cat# HPA023690, RRID:AB_1844633)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023690
Anti-AFF4 antibody produced in rabbit
AFF4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023690, RRID:AB_1844633)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA023690
Anti-AFF4 polyclonal antibody
AFF4 epitope: QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS See NCBI gene human
(Atlas Antibodies Cat# HPA023690, RRID:AB_1844633)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA023690