Showing 1 - 3 results out of 3 with the query:
AB_1845013
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ARID4B antibody produced in rabbit
Human ARID4B human
(Sigma-Aldrich Cat# HPA027333, RRID:AB_1845013)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA027333
Anti-ARID4B polyclonal antibody Go To Vendor
ARID4B epitope: DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR See NCBI gene human
(Atlas Antibodies Cat# HPA027333, RRID:AB_1845013)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA027333
Anti-ARID4B antibody produced in rabbit
ARID4B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA027333, RRID:AB_1845013)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA027333