Showing 1 - 3 results out of 3 with the query:
AB_1845070
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ASB6 antibody produced in rabbit
Human ASB6 human
(Sigma-Aldrich Cat# HPA004341, RRID:AB_1845070)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA004341
Anti-ASB6 antibody produced in rabbit
ASB6 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004341, RRID:AB_1845070)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA004341
Anti-ASB6 polyclonal antibody Go To Vendor
ASB6 epitope: IIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRD See NCBI gene human
(Atlas Antibodies Cat# HPA004341, RRID:AB_1845070)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004341