Showing 1 - 3 results out of 3 with the query:
AB_1845206
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ATP7B antibody produced in rabbit
Human ATP7B human
(Sigma-Aldrich Cat# HPA013187, RRID:AB_1845206)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA013187
Anti-ATP7B antibody produced in rabbit
ATP7B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA013187, RRID:AB_1845206)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA013187
Anti-ATP7B polyclonal antibody Go To Vendor
ATP7B epitope: RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPV See NCBI gene human
(Atlas Antibodies Cat# HPA013187, RRID:AB_1845206)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA013187