Showing 1 - 3 results out of 3 with the query:
AB_1845227
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-AZI1 antibody produced in rabbit
Human AZI1 human
(Sigma-Aldrich Cat# HPA024019, RRID:AB_1845227)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA024019
Anti-AZI1 antibody produced in rabbit
AZI1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA024019, RRID:AB_1845227)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA024019
Anti-CEP131 polyclonal antibody
CEP131 epitope: DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM See NCBI gene human
(Atlas Antibodies Cat# HPA024019, RRID:AB_1845227)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA024019