Showing 1 - 3 results out of 3 with the query:
AB_1845601
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-C17orf70 antibody produced in rabbit
Human C17orf70 human
(Sigma-Aldrich Cat# HPA023954, RRID:AB_1845601)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023954
Anti-FAAP100 polyclonal antibody Go To Vendor
FAAP100 epitope: VPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAGPIQAVEIQVESSSLA See NCBI gene human
(Atlas Antibodies Cat# HPA023954, RRID:AB_1845601)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA023954
Anti-C17orf70 antibody produced in rabbit
C17orf70 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023954, RRID:AB_1845601)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA023954