Showing 1 - 3 results out of 3 with the query:
AB_1845721
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-C5orf13 antibody produced in rabbit
Human C5orf13 human
(Sigma-Aldrich Cat# HPA000545, RRID:AB_1845721)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA000545
Anti-C5orf13 antibody produced in rabbit
C5orf13 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA000545, RRID:AB_1845721)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA000545
Anti-NREP polyclonal antibody
NREP epitope: YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL See NCBI gene human
(Atlas Antibodies Cat# HPA000545, RRID:AB_1845721)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA000545