Showing 1 - 3 results out of 3 with the query:
AB_1846065
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CTNNA3 antibody produced in rabbit
Human CTNNA3 human
(Sigma-Aldrich Cat# HPA017977, RRID:AB_1846065)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017977
Anti-CTNNA3 antibody produced in rabbit
CTNNA3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017977, RRID:AB_1846065)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA017977
Anti-CTNNA3 polyclonal antibody Go To Vendor
CTNNA3 epitope: AVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGK See NCBI gene human
(Atlas Antibodies Cat# HPA017977, RRID:AB_1846065)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGK; Manufacturer approved use: IHC
rabbit
Atlas Antibodies
HPA017977