Showing 1 - 3 results out of 3 with the query:
AB_1846426
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CDK5RAP3 antibody produced in rabbit
Affinity purified using the PrEST-antigen as affinity ligand Recombinant protein fragment 99 Length (aa) human
(Sigma-Aldrich Cat# HPA022141, RRID:AB_1846426)
polyclonal antibody
Used By NYUIHC-1330
rabbit
Sigma-Aldrich
HPA022141
Anti-CDK5RAP3 polyclonal antibody Go To Vendor
CDK5RAP3 epitope: LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA022141, RRID:AB_1846426)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022141
Anti-CDK5RAP3 antibody produced in rabbit
CDK5RAP3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022141, RRID:AB_1846426)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA022141