Showing 1 - 3 results out of 3 with the query:
AB_1847434
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CYP2C8 antibody produced in rabbit
Human CYP2C8 human
(Sigma-Aldrich Cat# HPA013970, RRID:AB_1847434)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA013970
Anti-CYP2C8 antibody produced in rabbit
CYP2C8 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA013970, RRID:AB_1847434)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA013970
Anti-CYP2C8 antibody
CYP2C8 epitope: ICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAG See NCBI gene human
(Atlas Antibodies Cat# HPA013970, RRID:AB_1847434)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA013970