Showing 1 - 3 results out of 3 with the query:
AB_1847509
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-DCLK2 antibody produced in rabbit
Human DCLK2 human
(Sigma-Aldrich Cat# HPA015770, RRID:AB_1847509)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA015770
Anti-DCLK2 polyclonal antibody Go To Vendor
DCLK2 epitope: ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEPISPVPPSVEEIPVPGEAVPAPTPPESPTPHCPPAAPGGERAG See NCBI gene human
(Atlas Antibodies Cat# HPA015770, RRID:AB_1847509)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA015770
Anti-DCLK2 antibody produced in rabbit
DCLK2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA015770, RRID:AB_1847509)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA015770