Showing 1 - 3 results out of 3 with the query:
AB_1847595
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-DEFA6 antibody produced in rabbit
Human DEFA6 human
(Sigma-Aldrich Cat# HPA019462, RRID:AB_1847595)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA019462
Anti-DEFA6 antibody
DEFA6 epitope: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC See NCBI gene human
(Atlas Antibodies Cat# HPA019462, RRID:AB_1847595)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA019462
Anti-DEFA6 antibody produced in rabbit
DEFA6 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA019462, RRID:AB_1847595)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA019462