Showing 1 - 3 results out of 3 with the query:
AB_1848013
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-NECAB1 antibody produced in rabbit
Human NECAB1 human
(Sigma-Aldrich Cat# HPA023252, RRID:AB_1848013)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023252
Anti-NECAB1 antibody
NECAB1 epitope: PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE See NCBI gene human, mouse
(Atlas Antibodies Cat# HPA023252, RRID:AB_1848013)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA023252
Anti-NECAB1 antibody produced in rabbit
NECAB1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023252, RRID:AB_1848013)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA023252