Showing 1 - 3 results out of 3 with the query:
AB_1848029
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-EFR3A antibody produced in rabbit
Human EFR3A human
(Sigma-Aldrich Cat# HPA022859, RRID:AB_1848029)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA022859
Anti-EFR3A antibody produced in rabbit
EFR3A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022859, RRID:AB_1848029)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA022859
Anti-EFR3A antibody Go To Vendor
EFR3A epitope: NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL See NCBI gene human
(Atlas Antibodies Cat# HPA022859, RRID:AB_1848029)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022859