Showing 1 - 3 results out of 3 with the query:
AB_1848440
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FBF1 antibody produced in rabbit
Human FBF1 human
(Sigma-Aldrich Cat# HPA023677, RRID:AB_1848440)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA023677
Anti-FBF1 antibody produced in rabbit
FBF1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA023677, RRID:AB_1848440)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA023677
Anti-FBF1 polyclonal antibody Go To Vendor
FBF1 epitope: ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP human
(Atlas Antibodies Cat# HPA023677, RRID:AB_1848440)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA023677