Showing 1 - 3 results out of 3 with the query:
AB_1848473
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FCER1G antibody produced in rabbit
Human FCER1G human
(Sigma-Aldrich Cat# HPA026872, RRID:AB_1848473)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA026872
Anti-FCER1G antibody produced in rabbit
FCER1G antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA026872, RRID:AB_1848473)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA026872
Anti-FCER1G polyclonal antibody Go To Vendor
FCER1G epitope: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ See NCBI gene human
(Atlas Antibodies Cat# HPA026872, RRID:AB_1848473)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA026872