Showing 1 - 3 results out of 3 with the query:
AB_1849014
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
FOSL2-human antibody Go To Vendor
FOSL2 homo sapiens
(Sigma-Aldrich Cat# HPA004817, RRID:AB_1849014)
unknown
ENCODE PROJECT External validation DATA SET is released testing lot R08705 for not specified; status is not pursued
rabbit
Sigma-Aldrich
HPA004817
Anti-FOSL2 antibody produced in rabbit
FOSL2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004817, RRID:AB_1849014)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot; Immunofluorescence
rabbit
Sigma-Aldrich
HPA004817
Anti-FOSL2 polyclonal antibody Go To Vendor
FOSL2 epitope: EKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSL See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA004817, RRID:AB_1849014)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004817