Showing 1 - 3 results out of 3 with the query:
AB_1849801
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GSTP1 antibody produced in rabbit
Human GSTP1 human
(Sigma-Aldrich Cat# HPA019869, RRID:AB_1849801)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA019869
Anti-GSTP1 antibody Go To Vendor
GSTP1 epitope: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS See NCBI gene human
(Atlas Antibodies Cat# HPA019869, RRID:AB_1849801)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA019869
Anti-GSTP1 antibody produced in rabbit
GSTP1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA019869, RRID:AB_1849801)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA019869