Showing 1 - 3 results out of 3 with the query:
AB_1849891
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GOPC antibody produced in rabbit
Human GOPC human
(Sigma-Aldrich Cat# HPA024018, RRID:AB_1849891)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA024018
Anti-GOPC antibody produced in rabbit
GOPC antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA024018, RRID:AB_1849891)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA024018
Anti-GOPC antibody Go To Vendor
GOPC epitope: IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY See NCBI gene human
(Atlas Antibodies Cat# HPA024018, RRID:AB_1849891)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA024018