Showing 1 - 3 results out of 3 with the query:
AB_1850443
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-GUCA2A antibody produced in rabbit
Human GUCA2A human
(Sigma-Aldrich Cat# HPA018215, RRID:AB_1850443)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA018215
Anti-GUCA2A polyclonal antibody Go To Vendor
GUCA2A epitope: SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC See NCBI gene human
(Atlas Antibodies Cat# HPA018215, RRID:AB_1850443)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA018215
Anti-GUCA2A antibody produced in rabbit
GUCA2A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA018215, RRID:AB_1850443)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA018215