Showing 1 - 3 results out of 3 with the query:
AB_1850711
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-HIGD2B antibody produced in rabbit
Human HIGD2B human
(Sigma-Aldrich Cat# HPA019016, RRID:AB_1850711)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA019016
Anti-HIGD2B polyclonal antibody Go To Vendor
HIGD2B epitope: MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP human
(Atlas Antibodies Cat# HPA019016, RRID:AB_1850711)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA019016
Anti-HIGD2B antibody produced in rabbit
HIGD2B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA019016, RRID:AB_1850711)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA019016