Showing 1 - 3 results out of 3 with the query:
AB_1851184
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-HSP90B1 antibody produced in rabbit
Human HSP90B1 human
(Sigma-Aldrich Cat# HPA008424, RRID:AB_1851184)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA008424
Anti-HSP90B1 antibody Go To Vendor
HSP90B1 epitope: WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS See NCBI gene human, mouse
(Atlas Antibodies Cat# HPA008424, RRID:AB_1851184)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA008424
Anti-HSP90B1 antibody produced in rabbit
HSP90B1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA008424, RRID:AB_1851184)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA008424