Showing 1 - 3 results out of 3 with the query:
AB_1851849
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-PNPLA8 antibody produced in rabbit
Human PNPLA8 human
(Sigma-Aldrich Cat# HPA020083, RRID:AB_1851849)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA020083
Anti-PNPLA8 polyclonal antibody Go To Vendor
PNPLA8 epitope: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE See NCBI gene human
(Atlas Antibodies Cat# HPA020083, RRID:AB_1851849)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA020083
Anti-PNPLA8 antibody produced in rabbit
PNPLA8 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA020083, RRID:AB_1851849)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA020083