Showing 1 - 3 results out of 3 with the query:
AB_1851994
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TAOK3 antibody produced in rabbit
Human TAOK3 human
(Sigma-Aldrich Cat# HPA017160, RRID:AB_1851994)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017160
Anti-TAOK3 antibody produced in rabbit
TAOK3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017160, RRID:AB_1851994)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017160
Anti-TAOK3 antibody Go To Vendor
TAOK3 epitope: ESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQSSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYRNR See NCBI gene human
(Atlas Antibodies Cat# HPA017160, RRID:AB_1851994)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017160