Showing 1 - 3 results out of 3 with the query:
AB_1852305
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-HECW1 antibody produced in rabbit
Human HECW1 human
(Sigma-Aldrich Cat# HPA007593, RRID:AB_1852305)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA007593
Anti-HECW1 antibody produced in rabbit
HECW1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA007593, RRID:AB_1852305)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA007593
Anti-HECW1 polyclonal antibody Go To Vendor
HECW1 epitope: EEEEKEQEEEGDVSTLEQGEGRLQLRASVKRKSRPCSLPVSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGSAAEEEDGAEEESTLKDSSEKDGLSEVDTVAADPSALE See NCBI gene human
(Atlas Antibodies Cat# HPA007593, RRID:AB_1852305)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA007593