Showing 1 - 3 results out of 3 with the query:
AB_1852727
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-LASS5 antibody produced in rabbit
Human LASS5 human
(Sigma-Aldrich Cat# HPA026589, RRID:AB_1852727)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA026589
Anti-CERS5 polyclonal antibody Go To Vendor
CERS5 epitope: GPLSLLWGWLWSERFWLPENVSWADLEGPADGYGY See NCBI gene human
(Atlas Antibodies Cat# HPA026589, RRID:AB_1852727)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GPLSLLWGWLWSERFWLPENVSWADLEGPADGYGY; Manufacturer approved use: ICC-IF, IHC
rabbit
Atlas Antibodies
HPA026589
Anti-LASS5 antibody produced in rabbit
LASS5 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA026589, RRID:AB_1852727)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA026589