Showing 1 - 3 results out of 3 with the query:
AB_1852996
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-KRBA2 antibody produced in rabbit
Human KRBA2 human
(Sigma-Aldrich Cat# HPA022849, RRID:AB_1852996)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA022849
Anti-KRBA2 antibody produced in rabbit
KRBA2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA022849, RRID:AB_1852996)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence
rabbit
Sigma-Aldrich
HPA022849
Anti-KRBA2 polyclonal antibody Go To Vendor
KRBA2 epitope: SVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSL See NCBI gene human
(Atlas Antibodies Cat# HPA022849, RRID:AB_1852996)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA022849