Showing 1 - 3 results out of 3 with the query:
AB_1853027
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FAM134C antibody produced in rabbit
Human FAM134C human
(Sigma-Aldrich Cat# HPA016492, RRID:AB_1853027)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA016492
Anti-FAM134C antibody produced in rabbit
FAM134C antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA016492, RRID:AB_1853027)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA016492
Anti-FAM134C polyclonal antibody
FAM134C epitope: DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA016492, RRID:AB_1853027)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA016492