Showing 1 - 3 results out of 3 with the query:
AB_1853311
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-LRRC37B antibody produced in rabbit
Human LRRC37B human
(Sigma-Aldrich Cat# HPA015134, RRID:AB_1853311)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA015134
Anti-LRRC37B antibody produced in rabbit
LRRC37B antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA015134, RRID:AB_1853311)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA015134
Anti-LRRC37B polyclonal antibody Go To Vendor
LRRC37B epitope: CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLK See NCBI gene human
(Atlas Antibodies Cat# HPA015134, RRID:AB_1853311)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQHMSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLK; Manufacturer approved use: IHC
rabbit
Atlas Antibodies
HPA015134